Proteintech, 13515-1-AP, MARVELD2 Polyclonal antibody

Size: 20ul / 150ul The MARVELD2 (13515-1-AP) by Proteintech is a Polyclonal antibody targeting MARVELD2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13515-1-AP targets MARVELD2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, mouse kidney tissue, rat kidney tissue Positive IHC detected in: human small intestine tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MARVELD2, also named as Tricellulin or TRIC, is a 558 amino acid protein, which contains one MARVEL domain. MARVELD2 localizes the cell membrane and plays a role in the formation of the epithelial barriers. MARVELD2, is a first integral membrane protein that is concentrated at the vertically oriented tight junction strands of tricellular contacts. MARVELD2 may be a component to maintain the integrity for peripheral nervous system myelin function and morphology. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4446 Product name: Recombinant human MARVELD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 365-558 aa of BC033689 Sequence: LWRHEAARRHREYMEQQEINEPSLSSKRKMCEMATSGDRQRDSEVNFKELRTAKMKPELLSGHIPPGHIPKPIVMPDYVAKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVMSRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIKQRIQEYDKVMNWDVQGYS Predict reactive species Full Name: MARVEL domain containing 2 Calculated Molecular Weight: 558 aa, 64 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC033689 Gene Symbol: MARVELD2 Gene ID (NCBI): 153562 RRID: AB_2281702 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N4S9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.