Iright
BRAND / VENDOR: Proteintech

Proteintech, 13521-1-AP, Glypican 2 Polyclonal antibody

CATALOG NUMBER: 13521-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Glypican 2 (13521-1-AP) by Proteintech is a Polyclonal antibody targeting Glypican 2 in WB, ELISA applications with reactivity to human, mouse samples 13521-1-AP targets Glypican 2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SH-SY5Y cells, unboiled mouse brain tissue, unboiled rat brain tissue, T-47D cells, mouse spleen tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Glypican 2 (GPC2) is a heparan sulfate proteoglycan that is linked to the outer leaflet of the plasma membrane via a glycosylphosphatidylinositol (GPI) linkage(PMID: 18505598). It is expected to be located in cell membrane and highly overexpressed in a high percentage of human neuroblastomas, medulloblastomas, and retinoblastomas. The calculated molecular weight of GPC2 is 62 kDa. And other bands are the result of glycosylation modification. Recent studies demonstrate that expression of the GPC2 protein is significantly increased in neuroblastoma and undetectable in normal tissues, including brain, heart, lung, and kidney, indicating that GPC2 is a suitable tumor antigen in neuroblastoma (PMID: 30352677). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4041 Product name: Recombinant human GPC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-332 aa of BC027972 Sequence: MSALRPLLLLLLPLCPGPGPGPGSEAKVTRSCAETRQVLGARGYSLNLIPPALISGEHLRVCPQEYTCCSSETEQRLIRETEATFRGLVEDSGSFLVHTLAARHRKFDEFFLEMLSVAQHSLTQLFSHSYGRLYAQHALIFNGLFSRLRDFYGESGEGLDDTLADFWAQLLERVFPLLHPQYSFPPDYLLCLSRLASSTDGSLQPFGDSPRRLRLQITRTLVAARAFVQGLETGRNVVSEALKVPVSEGCSQALMRLIGCPLCRGVPSLMPCQGFCLNVVRGCLSSRGLEPDWGNYLDGLLILADKLQGPFSFELTAESIGVKISEGLMYLQ Predict reactive species Full Name: glypican 2 Calculated Molecular Weight: 579 aa, 63 kDa Observed Molecular Weight: 62,70-100 kDa GenBank Accession Number: BC027972 Gene Symbol: GPC2 Gene ID (NCBI): 221914 RRID: AB_3085417 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N158 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924