Iright
BRAND / VENDOR: Proteintech

Proteintech, 13547-1-AP, TFEC Polyclonal antibody

CATALOG NUMBER: 13547-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TFEC (13547-1-AP) by Proteintech is a Polyclonal antibody targeting TFEC in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 13547-1-AP targets TFEC in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, COLO 320 cells Positive IP detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information The DNA-binding factor TFE3 contains adjacent helix-loop-helix (HLH) and leucine zipper (LZ) domains flanked by an upstream basic region. These protein motifs are frequently observed in other transcription factors and are particularly common to members of the Myc family. TFEC shares a bHLH/LZ structure with TFE3 and a closely related protein microphthalmia-associated transcription factor (MITF), which is critically involved in melanocyte differentiation. The expression of TFEC is mainly in fibroblasts, myoblasts, chondrosarcoma cells and myeloma cells. 50kDa TFEC isoforms are produced by alternative splicing (PMID: 29303964, PMID: 11467950). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4061 Product name: Recombinant human TFEC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-197 aa of BC029891 Sequence: MTLDHQIINPTLKWSQPAVPSGGPLVQHAHTTLDSDAGLTENPLTKLLAIGKEDDNAQWHLSGSILDVYSGEQGISPINMGLTSASCPSSLPMKREITETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVEYIKWLQKEQQRARELEHRQKKLEQANRRLLLRIQVFIRM Predict reactive species Full Name: transcription factor EC Calculated Molecular Weight: 347 aa, 39 kDa Observed Molecular Weight: 35-40 kDa, 65 kDa GenBank Accession Number: BC029891 Gene Symbol: TFEC Gene ID (NCBI): 22797 RRID: AB_2199629 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14948 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924