Proteintech, 13557-1-AP, BRUNOL5 Polyclonal antibody

Size: 20ul / 150ul The BRUNOL5 (13557-1-AP) by Proteintech is a Polyclonal antibody targeting BRUNOL5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13557-1-AP targets BRUNOL5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, U-251 cells Positive IHC detected in: mouse brain tissue, human gliomas tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information BRUNOL5, also named CELF5, is a 485 amino acid protein, which belongs to the CELF/BRUNOL family. BRUNOL5 is expressed in the brain and localizes in the nucleus. BRUNOL5 is an RNA-binding protein implicated in the regulation of pre-mRNA alternative splicing and mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. BRUNOL5 specifically activates exon 5 inclusion of cardiac isoforms of TNNT2 during heart remodeling at the juvenile to adult transition. BRUNOL5 exists in two isoforms with MV 52 and 45 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4416 Product name: Recombinant human BRUNOL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 135-485 aa of BC028101 Sequence: KLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDPGHPY Predict reactive species Full Name: bruno-like 5, RNA binding protein (Drosophila) Calculated Molecular Weight: 485 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC028101 Gene Symbol: BRUNOL5 Gene ID (NCBI): 60680 RRID: AB_1211624 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N6W0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.