Proteintech, 13590-1-AP, CLEC10A/CD301 Polyclonal antibody

Size: 20ul / 150ul The CLEC10A/CD301 (13590-1-AP) by Proteintech is a Polyclonal antibody targeting CLEC10A/CD301 in WB, ELISA applications with reactivity to human samples 13590-1-AP targets CLEC10A/CD301 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information C-type lectin domain family 10 member A (CLEC10A), also known as CD301, macrophage galactose-type C-type lectin (MGL), DC-asialoglyco protein receptor (DC-ASGP-R) or human macrophage lectin (HML), is a type II transmembrane glycoprotein having a calcium-dependent carbohydrate recognition domain (PMID: 8598452; 11919201; 11698450). CLEC10A is expressed exclusively by myeloid professional antigen-presenting cells such as immature dendritic cells (DCs) and alternatively activated macrophages (PMID: 16998493). CLEC10A is a marker for human CD1c+ DCs (cDC2) (PMID: 29755453). It functions as an endocytic receptor for glycosylated antigens (PMID: 11919201). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4490 Product name: Recombinant human CLEC10A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 66-316 aa of BC039011 Sequence: QRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH Predict reactive species Full Name: C-type lectin domain family 10, member A Calculated Molecular Weight: 316 aa, 35 kDa Observed Molecular Weight: 32 kDa, 28 kDa GenBank Accession Number: BC039011 Gene Symbol: CLEC10A Gene ID (NCBI): 10462 RRID: AB_2083131 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IUN9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.