Proteintech, 13598-1-AP, Cadherin-7 Polyclonal antibody

Size: 20ul / 150ul The Cadherin-7 (13598-1-AP) by Proteintech is a Polyclonal antibody targeting Cadherin-7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13598-1-AP targets Cadherin-7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells Positive IHC detected in: mouse brain tissue, mouse cerebellum tissue, human prostate cancer tissue, human gliomas tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4518 Product name: Recombinant human CDH7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 319-604 aa of BC036786 Sequence: QEGIITIQKELDFEAKTSYTLRIEAANKDADPRFLSLGPFSDTTTVKIIVEDVDEPPVFSSPLYPMEVSEATQVGNIIGTVAAHDPDSSNSPVRYSIDRNTDLERYFNIDANSGVITTAKSLDRETNAIHNITVLAMESQNPSQVGRGYVAITILDINDNAPEFAMDYETTVCENAQPGQVIQKISAVDKDEPSNGHQFYFSLTTDATNNHNFSLKDNKDNTASILTRRNGFRRQEQSVYYLPIFIVDSGSPSLSSTSTLTIRVCDCDADGVAQTCNAEAYVLPAG Predict reactive species Full Name: cadherin 7, type 2 Calculated Molecular Weight: 785 aa, 87 kDa Observed Molecular Weight: 87 kDa GenBank Accession Number: BC036786 Gene Symbol: Cadherin-7 Gene ID (NCBI): 1005 RRID: AB_2078256 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULB5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.