Iright
BRAND / VENDOR: Proteintech

Proteintech, 13620-1-AP, ST3GAL2 Polyclonal antibody

CATALOG NUMBER: 13620-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ST3GAL2 (13620-1-AP) by Proteintech is a Polyclonal antibody targeting ST3GAL2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13620-1-AP targets ST3GAL2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: COLO 205 cells, HL-60 cells, HT-29 cells, LoVo cells, mouse heart tissue, rat heart tissue Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Beta-galactoside alpha-2,3-sialyltransferase 2 (ST3GAL2) is a sialyltransferase (ST) that transfers sialic acid from the activated donor CMP-sialic acid to the glycan terminus of a glycolipid or glycoprotein. ST3GAL2 contains two putative N-glycosylation sites (Asn92 and Asn211), which are mainly responsible for GD1a and GT1b ganglioside biosynthesis in the brain. ST3GAL2 belongs to the sialyltransferase family, which mediates the terminal modification of glycoproteins and glycolipids. ST3GAL2 has been found to play a role in obesity, aging, and malignant diseases (PMID: 34319453). The calculated molecular weight of ST3GAL2 is 40 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4528 Product name: Recombinant human ST3GAL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-210 aa of BC036777 Sequence: SHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPA Predict reactive species Full Name: ST3 beta-galactoside alpha-2,3-sialyltransferase 2 Calculated Molecular Weight: 350 aa, 40 kDa Observed Molecular Weight: 40-43 kDa GenBank Accession Number: BC036777 Gene Symbol: ST3GAL2 Gene ID (NCBI): 6483 RRID: AB_2286561 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16842 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924