Iright
BRAND / VENDOR: Proteintech

Proteintech, 13623-1-AP, TRIM15 Polyclonal antibody

CATALOG NUMBER: 13623-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRIM15 (13623-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM15 in WB, IHC, ELISA applications with reactivity to human samples 13623-1-AP targets TRIM15 in WB, IHC, IP, ELISA, IF applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information TRIM15 (Tripartite motif-containing protein 15) is also named as RNF93, ZNF178, ZNFB7 and belongs to the TRIM/RBCC family. It acts as an ubiquitin-protein ligase and contributes to the endogenous restriction of retroviruses in cells. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4533 Product name: Recombinant human TRIM15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-270 aa of BC038585 Sequence: MPATPSLKVVHELPACTLCAGPLEDAVTIPCGHTFCRLCLPALSQMGAQSSGKILLCPLCQEEEQAETPMAPVPLGPLGETYCEEHGEKIYFFCENDAEFLCVFCREGPTHQAHTVGFLDEAIQPYRDRLRSRLEALSTERDEIEDVKCQEDQKLQVLLTQIESKKHQVETAFERLQQELEQQRCLLLARLRELEQQIWKERDEYITKVSEEVTRLGAQVKELEEKCQQPASELLQDVRVNQSRCEMKTFVSPEAISPDLVKKIRDFHRK Predict reactive species Full Name: tripartite motif-containing 15 Calculated Molecular Weight: 465 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC038585 Gene Symbol: TRIM15 Gene ID (NCBI): 89870 RRID: AB_2303892 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9C019 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924