Proteintech, 13638-1-AP, MAK Polyclonal antibody

Size: 20ul / 150ul The MAK (13638-1-AP) by Proteintech is a Polyclonal antibody targeting MAK in WB, ELISA applications with reactivity to human, mouse, rat samples 13638-1-AP targets MAK in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4571 Product name: Recombinant human MAK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-291 aa of BC039825 Sequence: MNRYTTMRQLGDGTYGSVLMGKSNESGELVAIKRMKRKFYSWDECMNLREVKSLKKLNHANVIKLKEVIRENDHLYFIFEYMKENLYQLMKDRNKLFPESVIRNIMYQILQGLAFIHKHGFFHRDMKPENLLCMGPELVKIADFGLARELRSQPPYTDYVSTRWYRAPEVLLRSSVYSSPIDVWAVGSIMAELYMLRPLFPGTSEVDEIFKICQVLGTPKKSDWPEGYQLASSMNFRFPQCVPINLKTLIPNASNEAIQLMTEMLNWDPKKRPTASQALKHPYFQVGQVLG Predict reactive species Full Name: male germ cell-associated kinase Calculated Molecular Weight: 623 aa, 71 kDa Observed Molecular Weight: 60-62 kDa GenBank Accession Number: BC039825 Gene Symbol: MAK Gene ID (NCBI): 4117 RRID: AB_10598167 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20794 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.