Proteintech, 13639-1-AP, DSS1 Polyclonal antibody

Size: 20ul / 150ul The DSS1 (13639-1-AP) by Proteintech is a Polyclonal antibody targeting DSS1 in IHC, ELISA applications with reactivity to human samples 13639-1-AP targets DSS1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human skin cancer tissue, human cervical cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4573 Product name: Recombinant human SHFM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC032782 Sequence: MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS Predict reactive species Full Name: split hand/foot malformation (ectrodactyly) type 1 Calculated Molecular Weight: 70 aa, 8 kDa GenBank Accession Number: BC032782 Gene Symbol: DSS1 Gene ID (NCBI): 7979 RRID: AB_2254633 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P60896 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.