Iright
BRAND / VENDOR: Proteintech

Proteintech, 13646-1-AP, Syntaphilin Polyclonal antibody

CATALOG NUMBER: 13646-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Syntaphilin (13646-1-AP) by Proteintech is a Polyclonal antibody targeting Syntaphilin in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13646-1-AP targets Syntaphilin in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse trachea tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Syntaphilin is a protein selectively expressed in brain. Syntaphilin competes with SNAP-25 for binding to syntaxin-1 and inhibits SNARE complex formation by absorbing free syntaxin-1, and thereby regulates synaptic vesicle exocytosis (PMID: 10707983). The deduced 537-amino acid syntaphilin protein contains an N-terminal proline-rich domain, a predicted coiled-coil domain, a putative C-terminal transmembrane domain, and numerous consensus sites for protein phosphorylation. Whereas the calculated molecular mass of syntaphilin is 58 kDa, the apparent molecular mass of 70-75 kDa is larger than the predicted mass, suggesting a posttranslational modification of syntaphilin (PMID: 9205841; 10707983). An extra band of 65 kDa was also detected by this antibody that may represent an alternative syntaphilin gene product or a stable degradation product (PMID: 10707983; 24457644). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4594 Product name: Recombinant human SNPH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 121-424 aa of BC035788 Sequence: WIEEECHRVEAQLALKEARKEIKQLKQVIDTVKNNLIDKDKGLQKYFVDINIQNKKLETLLHSMEVAQNGMAKEDGTGESAGGSPARSLTRSSTYTKLSDPAVCGDRQPGDPSSGSAEDGADSGFAAADDTLSRTDALEASSLLSSGVDCGTEETSLHSSFGLGPRFPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPELDAHPSGPRDPNSAVVVTVGDELEAPEPITRGPTPQRPGANPNPGQSVSVVCPMEEEEEAAVAEKEPKSYWSRH Predict reactive species Full Name: syntaphilin Calculated Molecular Weight: 538 aa, 58 kDa Observed Molecular Weight: 70-75 kDa, 65 kDa GenBank Accession Number: BC035788 Gene Symbol: SNPH Gene ID (NCBI): 9751 RRID: AB_2193555 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15079 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924