Iright
BRAND / VENDOR: Proteintech

Proteintech, 13656-1-AP, ENTPD2 Polyclonal antibody

CATALOG NUMBER: 13656-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ENTPD2 (13656-1-AP) by Proteintech is a Polyclonal antibody targeting ENTPD2 in WB, IHC, IP, ELISA applications with reactivity to human samples 13656-1-AP targets ENTPD2 in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue, K-562 cells Positive IP detected in: K-562 cells Positive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information ENTPD2(Ectonucleoside triphosphate diphosphohydrolase 2) is also named as CD39L1, Ecto-ATPase 2 and belongs to the GDA1/CD39 NTPase family. In the nervous system, it could hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. This protein has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4513 Product name: Recombinant human ENTPD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 38-323 aa of BC035738 Sequence: LKYGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSC Predict reactive species Full Name: ectonucleoside triphosphate diphosphohydrolase 2 Calculated Molecular Weight: 495 aa, 54 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC035738 Gene Symbol: ENTPD2 Gene ID (NCBI): 954 RRID: AB_2877966 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5L3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924