Iright
BRAND / VENDOR: Proteintech

Proteintech, 13664-1-AP, SFTPB Polyclonal antibody

CATALOG NUMBER: 13664-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SFTPB (13664-1-AP) by Proteintech is a Polyclonal antibody targeting SFTPB in WB, IHC, ELISA applications with reactivity to human samples 13664-1-AP targets SFTPB in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human lung tissue, A549 cells Positive IHC detected in: human lung cancer tissue, human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Pulmonary surfactant-associated protein B(SFTPB) also named SFTP3, is a hydrophobic peptide that facilitates the formation and maintenance of a phospholipid-rich film at the alveolar air-liquid interface. SP-B is necessary for postnatal lung function. SFTPB as a risk biomarker for lung cancer. (PMID:36460583). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4576 Product name: Recombinant human SFTPB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-381 aa of BC032785 Sequence: MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL Predict reactive species Full Name: surfactant protein B Calculated Molecular Weight: 381 aa, 42 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC032785 Gene Symbol: SFTPB Gene ID (NCBI): 6439 RRID: AB_2185487 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07988 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924