Proteintech, 13672-1-AP, ATP11B Polyclonal antibody

Size: 20ul / 150ul The ATP11B (13672-1-AP) by Proteintech is a Polyclonal antibody targeting ATP11B in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13672-1-AP targets ATP11B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4654 Product name: Recombinant human ATP11B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10-104 aa of BC033880 Sequence: SSGSAWFAIILMVVTCLFLDIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRCEISLSSLCCR Predict reactive species Full Name: ATPase, class VI, type 11B Calculated Molecular Weight: 1177aa, 134 kDa GenBank Accession Number: BC033880 Gene Symbol: ATP11B Gene ID (NCBI): 23200 RRID: AB_2063150 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2G3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.