Iright
BRAND / VENDOR: Proteintech

Proteintech, 13675-1-AP, Calpain 11 Polyclonal antibody

CATALOG NUMBER: 13675-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Calpain 11 (13675-1-AP) by Proteintech is a Polyclonal antibody targeting Calpain 11 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13675-1-AP targets Calpain 11 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Calpains are a superfamily of related proteins, some of which have been shown to function as intracellular calcium-dependent cysteine proteases. Calpains consist of a variable large (80 kDa) subunit and an invariant small (30 kDa) subunit. The expression of calpain11 during spermatogenesis and its localization is spermatozoa suggest that it is involved in regulating calcium-dependent signal transduction events during meiosis and sperm functional processes(PMID:16541461). And the 110 kDa band protein may be regarded as a complex. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4668 Product name: Recombinant human CAPN11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 352-702 aa of BC033733 Sequence: YWHTTFYEGSWRRGSSAGGCRNHPGTFWTNPQFKISLPEGDDPEDDAEGNVVACTCLVALMQKNWRHARQQGAQLQTIGFVLYAVPKEFQNIQDVHLKKEFFTKYQDHGFSEIFTNSREVSSQLRLPPGEYIIIPSTFEPHRDADFLLRVFTEKHSESWELDEVNYAEQLQEEKVSEDDMDQDFLHLFKIVAGEGKEIGVYELQRLLNRMAIKFKSFKTKGFGLDACRCMINLMDKDGSGKLGLLEFKILWKKLKKWMDIFRECDQDHSGTLNSYEMRLVIEKAGIKLNNKVMQVLVARYADDDLIIDFDSFISCFLRLKTMFTFFLTMDPKNTGHICLSLEQWLQMTMWG Predict reactive species Full Name: calpain 11 Calculated Molecular Weight: 702 aa, 81 kDa Observed Molecular Weight: 81 kDa GenBank Accession Number: BC033733 Gene Symbol: Calpain 11 Gene ID (NCBI): 11131 RRID: AB_2069480 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UMQ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924