Proteintech, 13682-1-AP, DDO Polyclonal antibody

Size: 20ul / 150ul The DDO (13682-1-AP) by Proteintech is a Polyclonal antibody targeting DDO in IP, ELISA applications with reactivity to human, mouse, rat samples 13682-1-AP targets DDO in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IP detected in: SKOV-3 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4543 Product name: Recombinant human DDO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-369 aa of BC032786 Sequence: MRPARHWETRFGARDFGGFQDCFFRDRLMDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMTEAELKKFPQYVFGQAFTTLKCECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL Predict reactive species Full Name: D-aspartate oxidase Calculated Molecular Weight: 369 aa, 41 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC032786 Gene Symbol: DDO Gene ID (NCBI): 8528 RRID: AB_2877970 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99489 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.