Iright
BRAND / VENDOR: Proteintech

Proteintech, 13691-1-AP, HERC4 Polyclonal antibody

CATALOG NUMBER: 13691-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HERC4 (13691-1-AP) by Proteintech is a Polyclonal antibody targeting HERC4 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13691-1-AP targets HERC4 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human brain tissue, human placenta tissue, human testis tissue, mouse testis tissue, rat testis tissue Positive IP detected in: HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HERC4, also known as HECT and RLD domain containing E3 ubiquitin protein ligase 4, is a protein encoded by the HERC4 gene in humans. HERC4 is a novel member of HERC family. The mRNA of HERC4 has been found in all examined tissues, with its levels being significantly higher in the brain and testis than in the placenta and heart. (PMID: 28430527) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4566 Product name: Recombinant human HERC4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 723-1049 aa of BC039600 Sequence: NIDYKKPLKVIFVGEDAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSRLIWFSDKTFEDSDLFHLIGVICGLAIYNCTIVDLHFPLALYKKLLKKKPSLDDLKELMPDVGRSMQQLLDYPEDDIEETFCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAYVDYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQPNELQAMVIGNTNYDWKELEKNTEYKGEYWAEHPTIKIFWEVFHELPLEKKKQFLLFLTGSDRIPILGMKSLKLVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAIDHNEGFSLI Predict reactive species Full Name: hect domain and RLD 4 Calculated Molecular Weight: 1049 aa, 118 kDa Observed Molecular Weight: 107 kDa GenBank Accession Number: BC039600 Gene Symbol: HERC4 Gene ID (NCBI): 26091 RRID: AB_10596480 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5GLZ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924