Proteintech, 13697-1-AP, PRKACG Polyclonal antibody

Size: 20ul / 150ul The PRKACG (13697-1-AP) by Proteintech is a Polyclonal antibody targeting PRKACG in WB, ELISA applications with reactivity to human, mouse, rat samples 13697-1-AP targets PRKACG in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue, mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4595 Product name: Recombinant human PRKACG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC039888 Sequence: MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCPKEFSEF Predict reactive species Full Name: protein kinase, cAMP-dependent, catalytic, gamma Calculated Molecular Weight: 351 aa, 40 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC039888 Gene Symbol: PRKACG Gene ID (NCBI): 5568 RRID: AB_3085421 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22612 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.