Iright
BRAND / VENDOR: Proteintech

Proteintech, 13698-1-AP, IRF2BP1 Polyclonal antibody

CATALOG NUMBER: 13698-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IRF2BP1 (13698-1-AP) by Proteintech is a Polyclonal antibody targeting IRF2BP1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13698-1-AP targets IRF2BP1 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, mouse brain tissue, rat lymph tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information IRF2BP1 inhibits IRF2-mediated transcriptional activation by interacting with IRF2. In epidermal growth factor receptor (EGFR) signaling, transient deSUMOylation of IRF2BP1 is essential for the proper expression of immediate early genes such as DUSP1 and ATF3. IRF2BP1 is also involved in the TGF-β signaling pathway by controlling the accumulation of cPML in the cytoplasm, which in turn affects the phosphorylation of Smad2 and the assembly of the Smad2-receptor complex. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4596 Product name: Recombinant human IRF2BP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 234-584 aa of BC038222 Sequence: LALSACAPFNVRFKKDHGLVGRVFAFDATARPPGYEFELKLFTEYPCGSGNVYAGVLAVARQMFHDALREPGKALASSGFKYLEYERRHGSGEWRQLGELLTDGVRSFREPAPAEALPQQYPEPAPAALCGPPPRAPSRNLAPTPRRRKASPEPEGEAAGKMTTEEQQQRHWVAPGGPYSAETPGVPSPIAALKNVAEALGHSPKDPGGGGGPVRAGGASPAASSTAQPPTQHRLVARNGEAEVSPTAGAEAVSGGGSGTGATPGAPLCCTLCRERLEDTHFVQCPSVPGHKFCFPCSREFIKAQGPAGEVYCPSGDKCPLVGSSVPWAFMQGEIATILAGDIKVKKERDP Predict reactive species Full Name: interferon regulatory factor 2 binding protein 1 Calculated Molecular Weight: 584 aa, 62 kDa Observed Molecular Weight: 62-72 kDa GenBank Accession Number: BC038222 Gene Symbol: IRF2BP1 Gene ID (NCBI): 26145 RRID: AB_2126853 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IU81 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924