Proteintech, 13712-1-AP, PNCK Polyclonal antibody

Size: 20ul / 150ul The PNCK (13712-1-AP) by Proteintech is a Polyclonal antibody targeting PNCK in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13712-1-AP targets PNCK in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, rat brain tissue Positive IHC detected in: human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:9000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4650 Product name: Recombinant human PNCK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-121 aa of BC033746 Sequence: MLLLKKHTEDISSVYEIRERLGSGPSPLHSLSLLPLLSSHFLPTSHRPVCGRGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMEL Predict reactive species Full Name: pregnancy up-regulated non-ubiquitously expressed CaM kinase Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 38 kDa, 45 kDa GenBank Accession Number: BC033746 Gene Symbol: PNCK Gene ID (NCBI): 139728 RRID: AB_10642952 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6P2M8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.