Proteintech, 13715-1-AP, LSS Polyclonal antibody

Size: 20ul / 150ul The LSS (13715-1-AP) by Proteintech is a Polyclonal antibody targeting LSS in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13715-1-AP targets LSS in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-1376 cells, PC-3 cells, HeLa cells, HepG2 cells, mouse testis tissue, human brain tissue, mouse pancreas tissue, mouse liver tissue, SH-SY5Y cells Positive IP detected in: HepG2 cells Positive IHC detected in: human liver tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information LSS, also named as OSC, is lanosterol synthase which catalyzes the cyclization of (S)-2,3 oxidosqualene to lanosterol, a reaction that forms the sterol nucleus. LSS gene has three isoforms with MW 74 kDa and 82-85 kDa. This antibody can recognize all these three isoforms. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, rabbit Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4655 Product name: Recombinant human LSS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 382-732 aa of BC035638 Sequence: NGSQIWDTAFAIQALLEAGGHHRPEFSSCLQKAHEFLRLSQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQALKYFHKRFPEHRAAEIRETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMGQTYRDGTACAEVSRACDFLLSRQMADGGWGEDFESCEERRYVQSAQSQIHNTCWAMMGLMAVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGRFSQLYPERALAGHP Predict reactive species Full Name: lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase) Calculated Molecular Weight: 732 aa, 83 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC035638 Gene Symbol: LSS Gene ID (NCBI): 4047 RRID: AB_10597096 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48449 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.