Iright
BRAND / VENDOR: Proteintech

Proteintech, 13726-1-AP, AUP1 Polyclonal antibody

CATALOG NUMBER: 13726-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AUP1 (13726-1-AP) by Proteintech is a Polyclonal antibody targeting AUP1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13726-1-AP targets AUP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, HEK-293 cells, Jurkat cells Positive IP detected in: HEK-293 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information AUP1 (Ancient ubiquitous protein 1) is a protein associated with lipid metabolism, which is widely expressed on the surface of ER and Lipid droplets, involved in the degradation of misfolded proteins through autophagy (PMID: 37029364). In addition, AUP1 also controls lipid synthesis as it induces ubiquitination and the subsequent degradation of several key regulators of lipid biosynthesis, such as the cholesterol biosynthetic enzyme 3-hydroxy-3-methylglutaryl-coenzyme A reductase (PMID: 28330944). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4680 Product name: Recombinant human AUP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 134-437 aa of BC033646 Sequence: LLTTCSTPLLNSPPSFVCWSRGFMEMNGRGELVESLKRFCASTRLPPTPLLLFPEEEATNGREGLLRFSSWPFSIQDVVQPLTLQVQRPLVSVTVSDASWVSELLWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPTASASKFPSSGPVTPQPTALTFAKSSWARQESLQERKQALYEYARRRFTERRAQEAD Predict reactive species Full Name: ancient ubiquitous protein 1 Calculated Molecular Weight: 416 aa, 45 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC033646 Gene Symbol: AUP1 Gene ID (NCBI): 550 RRID: AB_2258768 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y679 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924