Iright
BRAND / VENDOR: Proteintech

Proteintech, 13729-1-AP, CACNG3 Polyclonal antibody

CATALOG NUMBER: 13729-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CACNG3 (13729-1-AP) by Proteintech is a Polyclonal antibody targeting CACNG3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13729-1-AP targets CACNG3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse kidney tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Voltage-dependent calcium channels couple membrane depolarization in a number of cellular processes. These activities are regulated by distinct channels composed of alpha-1, beta, alpha-2/delta, and gamma subunits. CACNG3, one of the eight gamma subunits in human, is a type I transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4730 Product name: Recombinant human CACNG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 202-315 aa of BC040005 Sequence: EKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPANRRTTPV Predict reactive species Full Name: calcium channel, voltage-dependent, gamma subunit 3 Calculated Molecular Weight: 315 aa, 36 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC040005 Gene Symbol: CACNG3 Gene ID (NCBI): 10368 RRID: AB_2070085 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60359 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924