Proteintech, 13732-1-AP, CD99L2 Polyclonal antibody

Size: 20ul / 150ul The CD99L2 (13732-1-AP) by Proteintech is a Polyclonal antibody targeting CD99L2 in WB, ELISA applications with reactivity to human samples 13732-1-AP targets CD99L2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CD99L2 (CD99 molecule like 2), also known as CD99B and MIC2L1, is a type 1 transmembrane protein that is similar to CD99 (PMID: 12706889). It is expressed on most leukocytes and several other cell types including neuronal cells (PMID: 12706889). CD99L2 may function as a homophilic adhesion molecule as well as play a role in a late step of leukocyte extravasation helping cells to overcome the endothelial basement membrane (PMID: 37199607). Its related pathways respond to elevated platelet cytosolic Ca2+ and cell surface interactions at the vascular wall. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3809 Product name: Recombinant human CD99L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-113 aa of BC025729 Sequence: TLVQRGSGDFDDFNLEDAVKETSSVKPALGMYHKLDGLKQQNFILSLFWMLEVLYQGVGWATFSLKALGKNLSLTFPTSGGSRCSLVCGCITPISA Predict reactive species Full Name: CD99 molecule-like 2 Calculated Molecular Weight: 262 aa, 28 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC025729 Gene Symbol: CD99L2 Gene ID (NCBI): 83692 RRID: AB_3669170 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TCZ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.