Iright
BRAND / VENDOR: Proteintech

Proteintech, 13738-1-AP, CUL7 Polyclonal antibody

CATALOG NUMBER: 13738-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CUL7 (13738-1-AP) by Proteintech is a Polyclonal antibody targeting CUL7 in WB, ELISA applications with reactivity to human samples 13738-1-AP targets CUL7 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information The cullin family proteins are scaffold proteins for the Ring finger type E3 ligases, participating in the proteolysis through the ubiquitin-proteasome pathway. Humans express seven cullin proeins: CUL1-3, CUL4A, CUL4B, CUL5, and CUL7. Each cullin protein can form an E3 ligase similar to the prototype Ring-type E3 ligase Skp1-CUL1-F-box complex. The Cullin-RING-finger type E3 ligases are important regulators in early embryonic development, as highlighted by genetic studies demonstrating that knock-out of CUL1, CUL3, or CUL4A in mice results in early embryonic lethality. CUL7 was originally discovered as 185-kDa protein associated with the large T antigen of simian virus 40 (SV40). CUL7-deficient mice exhibit neonatal lethality with reduced size and vascular defects. CUL7 presumably plays a role in the DNA damage response by limiting p53 activity. CUL7 mutations have also been identified in 3-Msyndrome and the Yakuts short stature syndrome, both of which are characterized by pre- and post-natal growth retardation but with relatively normal mental and endocrine functions, suggesting that CUL7 may also be crucial for human placental development. Specification Tested Reactivity: human Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4675 Product name: Recombinant human CUL7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1348-1698 aa of BC033647 Sequence: GKEHKSEKEEEAGAAAVVDVAEGEEEEEENEDLYYEGAMPEVSVLVLSRHSWPVASICHTLNPRTCLPSYLRGTLNRYSNFYNKSQSHPALERGSQRRLQWTWLGWAELQFGNQTLHVSTVQMWLLLYLNDLKAVSVESLLAFSGLSADMLNQAIGPLTSSRGPLDLHEQKDIPGGVLKIRDGSKEPRSRWDIVRLIPPQTYLQAEGEDGQNLEKRRNLLNCLIVRILKAHGDEGLHIDQLVCLVLEAWQKGPCPPRGLVSSLGKGSACSSTDVLSCILHLLGKGTLRRHDDRPQVLSYAVPVTVMEPHTESLNPGSSGPNPPLTFHTLQIRSRGVPYASCTATQSFSTFR Predict reactive species Full Name: cullin 7 Calculated Molecular Weight: 1698 aa, 191 kDa Observed Molecular Weight: 185 kDa GenBank Accession Number: BC033647 Gene Symbol: CUL7 Gene ID (NCBI): 9820 RRID: AB_10640531 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14999 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924