Iright
BRAND / VENDOR: Proteintech

Proteintech, 13741-1-AP, TPM4 Polyclonal antibody

CATALOG NUMBER: 13741-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TPM4 (13741-1-AP) by Proteintech is a Polyclonal antibody targeting TPM4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13741-1-AP targets TPM4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, HeLa cells, rat skeletal muscle tissue Positive IHC detected in: human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TPM4, also named as TM30p1, Tropomyosin 4, Tropomyosin alpha 4 chain. This gene is one gene type of tropomyosin isoforms and encodes a member of the tropomyosin family of actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is a major regulatory protein of cytoskeleton and is localized along actin filaments modulating the interaction of actin and myosin (PubMed: 26315888, PubMed: 32638329). In addition, TPM4 has been reported as an oncoprotein in several malignancies (PubMed: 37459535). The calculated molecular weight of TPM4 is usually approximately 28 kDa. It maybe have two isoforms: the short 30-kDa isoform (TPM4.2) and the long 38-kDa isoform (TPM4.1) (PubMed: 28134622). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4679 Product name: Recombinant human TPM4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-248 aa of BC037576 Sequence: MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI Predict reactive species Full Name: tropomyosin 4 Calculated Molecular Weight: 248 aa, 29 kDa Observed Molecular Weight: 32-35 kDa GenBank Accession Number: BC037576 Gene Symbol: TPM4 Gene ID (NCBI): 7171 ENSEMBL Gene ID: ENSG00000167460 RRID: AB_2205772 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P67936 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924