Iright
BRAND / VENDOR: Proteintech

Proteintech, 13748-1-AP, KCNIP4 Polyclonal antibody

CATALOG NUMBER: 13748-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KCNIP4 (13748-1-AP) by Proteintech is a Polyclonal antibody targeting KCNIP4 in WB, ELISA applications with reactivity to human, mouse, rat samples 13748-1-AP targets KCNIP4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4688 Product name: Recombinant human KCNIP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-250 aa of BC032520 Sequence: MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI Predict reactive species Full Name: Kv channel interacting protein 4 Calculated Molecular Weight: 250 aa, 28 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC032520 Gene Symbol: KCNIP4 Gene ID (NCBI): 80333 RRID: AB_2265212 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6PIL6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924