Proteintech, 13749-1-AP, KLF15 Polyclonal antibody

Size: 20ul / 150ul The KLF15 (13749-1-AP) by Proteintech is a Polyclonal antibody targeting KLF15 in WB, ELISA applications with reactivity to human, mouse samples 13749-1-AP targets KLF15 in WB, IF, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, MDA-MB-231 cells, 3T3-L1 cells, C2C12 cells, mouse heart tissue, mouse kidney tissue, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information KLF15, a kidney-enriched Krüppel-like zinc finger-containing transcription factors, is a transcriptonal activator that binds the CLCNKA promoter. The nuclear protein KLF15, is expressed primarily in liver, heart, skeletal muscle and kidney tissues but is not detected in lymphoid tissues or bone marrow. It is an important regulator of GLUT4 in both adipose and muscle tissues.Although the calculated molecular mass of KLF15 is 44 kDa, the apparent molecular mass on SDS-PAGE is 65 kDa due to the post-translational modifications (PMID:10982849,PMID:16615998). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4690 Product name: Recombinant human KLF15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-416 aa of BC036733 Sequence: MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQALCSCYGGGLGTESQDSILDFLLSQATLGSGGGSGSSIGASSGPVAWGPWRRAAAPVKGEHFCLPEFPLGDPDDVPRPFQPTLEEIEEFLEENMEPGVKEVPEGNSKDLDACSQLSAGPHKSHLHPGSSGRERCSPPPGGASAGGAQGPGGGPTPDGPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGPAGLLMGQKFPKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSSRSVRSVN Predict reactive species Full Name: Kruppel-like factor 15 Calculated Molecular Weight: 416 aa, 44 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC036733 Gene Symbol: KLF15 Gene ID (NCBI): 28999 RRID: AB_2132428 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UIH9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.