Iright
BRAND / VENDOR: Proteintech

Proteintech, 13770-1-AP, TRAK2 Polyclonal antibody

CATALOG NUMBER: 13770-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRAK2 (13770-1-AP) by Proteintech is a Polyclonal antibody targeting TRAK2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13770-1-AP targets TRAK2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human liver tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Trafficking kinesin-binding protein 2 (TRAK2) is a member of the TRAK family of kinesin adaptor proteins. In mammals, there are two members of the TRAK family, TRAK1 and TRAK2 (PMID: 25653102). TRAK1 and TRAK2 play roles in lysosomal and mitochondrial trafficking in cells. They function as kinesin adaptors linking kinesin heavy chain (KHC) to mitochondria (PMID: 28364549). TRAK2 has been found to act as a trafficking factor for the K+ channel Kir2.1 and γ-Aminobutyric acid type A (GABAA) receptor (PMID: 16895905; 24122114). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4753 Product name: Recombinant human TRAK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-354 aa of BC040668 Sequence: MSQSQNAIFTSPTGEENLMNSNHRDSESITDVCSNEDLPEVELVSLLEEQLPQYRLKVDTLFLYENQDWTQSPHQRQHASDALSPVLAEETFRYMILGTDRVEQMTKTYNDIDMVTHLLAERDRDLELAARIGQALLKRNHILSEQNESLEEQLGQAFDQVNQLQHELCKKDELLRIVSIASEESETDSSCSTPLRFNESFSLSQGLLQLEMLQEKLKELEEENMALRSKACHIKTETVTYEEKEQQLVSDCVKELRETNAQMSRMTEELSGKSDELVRYQEELSSLLSQIVDLQHKLKEHVIEKEELKLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEEIKELRSRS Predict reactive species Full Name: trafficking protein, kinesin binding 2 Calculated Molecular Weight: 914 aa, 101 kDa Observed Molecular Weight: 101-106 kDa GenBank Accession Number: BC040668 Gene Symbol: TRAK2 Gene ID (NCBI): 66008 RRID: AB_2207961 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60296 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924