Proteintech, 13778-1-AP, TSLP Polyclonal antibody

Size: 20ul / 150ul TSLP Polyclonal Antibody for IHC, ELISA 13778-1-AP targets TSLP in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human kidney tissue, human testis tissue, human spleen tissue, human lung tissue, human ovary tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TSLP is a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain, it mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. Another isoform of this protein may act as an antimicrobial peptide in the oral cavity and on the skin (PMID: 24850429). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4771 Product name: Recombinant human TSLP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 79-159 aa of BC016720 Sequence: IQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ Predict reactive species Full Name: thymic stromal lymphopoietin Calculated Molecular Weight: 15 kDa, 42 kDa GenBank Accession Number: BC016720 Gene Symbol: TSLP Gene ID (NCBI): 85480 RRID: AB_2208528 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969D9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.