Iright
BRAND / VENDOR: Proteintech

Proteintech, 13782-1-AP, CPNE6 Polyclonal antibody

CATALOG NUMBER: 13782-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CPNE6 (13782-1-AP) by Proteintech is a Polyclonal antibody targeting CPNE6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13782-1-AP targets CPNE6 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: rat dorsal root ganglion tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Copines are a family of evolutionarily conserved calcium-dependent phospholipid-binding proteins (PMID: 9430674). They contain two Ca(2+)- and phospholipid-binding domains known as C2 domains. Copines are potentially involved in regulating membrane trafficking and in protein-protein interactions. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4789 Product name: Recombinant human CPNE6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 258-557 aa of BC018046 Sequence: QEMQWDCINPKYRDKKKNYKSSGTVVLAQCTVEKVHTFLDYIMGGCQISFTVAIDFTASNGDPRSSQSLHCLSPRQPNHYLQALRAVGGICQDYDSDKRFPAFGFGARIPPNFEVSHDFAINFDPENPECEEISGVIASYRRCLPQIQLYGPTNVAPIINRVAEPAQREQSTGQATKYSVLLVLTDGVVSDMAETRTAIVRASRLPMSIIIVGVGNADFSDMRLLDGDDGPLRCPRGVPAARDIVQFVPFRDFKDAAPSALAKCVLAEVPRQVVEYYASQGISPGAPRPCTLATTPSPSP Predict reactive species Full Name: copine VI (neuronal) Calculated Molecular Weight: 557 aa, 62 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC018046 Gene Symbol: CPNE6 Gene ID (NCBI): 9362 RRID: AB_2292172 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95741 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924