Iright
BRAND / VENDOR: Proteintech

Proteintech, 13791-1-AP, Spartin/SPG20 Polyclonal antibody

CATALOG NUMBER: 13791-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Spartin/SPG20 (13791-1-AP) by Proteintech is a Polyclonal antibody targeting Spartin/SPG20 in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 13791-1-AP targets Spartin/SPG20 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, PANC-1 cells Positive IP detected in: HeLa cells Positive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information SPG20 (spastic paraplegia 20) gene encodes a multifunctional Spartin protein. SPG20 protein is highly expressed in adipose tissue and may be implicated in endosomal trafficking and microtubule dynamics. SPG20 is mutated in Troyer syndrome, a hereditary spastic paraplegia defined by degeneration of upper motor neurons, recent study showed that regulation of SPG20 on mitochondrial calcium homeostasis may contribute to the pathophysiology of Troyer syndrome. Hypermethylation of SPG20 promoter, found in colorectal cancer patients, may play a role in cytokinesis arrest in colorectal tumorigenesis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4815 Product name: Recombinant human Spartin, SPG20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC047083 Sequence: MEQEPQNGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGTGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPKLYPEFPPKDMCEKLPEPQSFSSAPQHAEVNGNTSTPSAGAVAAPASLSLPSQSCPAEAPPAYTPQAAEGHYTVSYGTDSGEFSSVGEEFYRNHSQPPPLETLGLDADELILIPNGVQIFFVNPAGEVSAPSYPGYLRIVRFLDNSLDTVLNRPPGFLQVCDWLYPLVPDRSPVLKCTAGAYMFPDTMLQAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEEENEFQI Predict reactive species Full Name: spastic paraplegia 20 (Troyer syndrome) Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 75-84 kDa GenBank Accession Number: BC047083 Gene Symbol: Spartin Gene ID (NCBI): 23111 RRID: AB_2195683 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N0X7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924