Iright
BRAND / VENDOR: Proteintech

Proteintech, 13792-1-AP, PRDM4 Polyclonal antibody

CATALOG NUMBER: 13792-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PRDM4 (13792-1-AP) by Proteintech is a Polyclonal antibody targeting PRDM4 in WB, ELISA applications with reactivity to human, mouse, rat samples 13792-1-AP targets PRDM4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information The PRDM family members are characterized by the presence of a PR (positive regulatory) domain and multiple zinc finger (ZnFg) domains. The PR domain defines a family of transcription factors involved in cell differentiation and tumorigenesis. PRDM proteins are either epigenetic modifiers in their own right or else they recruit third party chromatin modifiers - e.g. histone deacetylases (HDACs), histone lysine MTases or histone arginine MTases - to regulate cell type-specific gene expression in various tissues (PRDM4 as an HDAC-associated transcriptional repressor that modulates cell cycle progression. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4580 Product name: Recombinant human PRDM4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 451-801 aa of BC035581 Sequence: EVAEWTDKAVNHIWKIYHNGVLEFCIITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSRDYAQQIGVPEHPDVHLCNCGKECNSYTEFKAHLTSHIHNHLPTQGHSGSHGPSHSKERKWKCSMCPQAFISPSKLHVHFMGHMGMKPHKCDFCSKAFSDPSNLRTHLKIHTGQKNYRCTLCDKSFTQKAHLESHMVIHTGEKNLKCDYCDKLFMRRQDLKQHVLIHTQERQIKCPKCDKLFLRTNHLKKHLNSHEGKRDYVCEKCTKAYLTKYHLTRHLKTCKGPTSSSSAPEEEEEDDSEEEDLADSVGTEDCRINSAVYSADESLSAHK Predict reactive species Full Name: PR domain containing 4 Calculated Molecular Weight: 801 aa, 88 kDa Observed Molecular Weight: 88 kDa GenBank Accession Number: BC035581 Gene Symbol: PRDM4 Gene ID (NCBI): 11108 RRID: AB_10638307 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKN5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924