Iright
BRAND / VENDOR: Proteintech

Proteintech, 13793-1-AP, ELP2 Polyclonal antibody

CATALOG NUMBER: 13793-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ELP2 (13793-1-AP) by Proteintech is a Polyclonal antibody targeting ELP2 in IHC, ELISA applications with reactivity to human, mouse, rat samples 13793-1-AP targets ELP2 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human stomach cancer tissue, mouse liver tissue, human colon cancer tissue, mouse kidney tissue, rat kidney tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information ELP2 is a component of the elongator complex which is required for multiple tRNA modifications. The elongator complex catalyzes the formation of carboxymethyluridine in the wobble base at position 34 in tRNAs. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4581 Product name: Recombinant human ELP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 406-756 aa of BC032553 Sequence: AITGQSLNHVLCNQDSDLPEGATVPALGLSNKAVFQGDIASQPSDEEELLTSTGFEYQQVAFQPSILTEPPTEDHLLQNTLWPEVQKLYGHGYEIFCVTCNSSKTLLASACKAAKKEHAAIILWNTTSWKQVQNLVFHSLTVTQMAFSPNEKFLLAVSRDRTWSLWKKQDTISPEFEPVFSLFAFTNKITSVHSRIIWSCDWSPDSKYFFTGSRDKKVVVWGECDSTDDCIEHNIGPCSSVLDVGGAVTAVSVCPVLHPSQRYVVAVGLECGKICLYTWKKTDQVPEINDWTHCVETSQSQSHTLAIRKLCWKNCSGKTEQKEAEGAEWLHFASCGEDHTVKIHRVNKCAL Predict reactive species Full Name: elongation protein 2 homolog (S. cerevisiae) Calculated Molecular Weight: 826 aa, 93 kDa GenBank Accession Number: BC032553 Gene Symbol: ELP2 Gene ID (NCBI): 55250 RRID: AB_3085423 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6IA86 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924