Proteintech, 13807-1-AP, DARS2 Polyclonal antibody

Size: 20ul / 150ul The DARS2 (13807-1-AP) by Proteintech is a Polyclonal antibody targeting DARS2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13807-1-AP targets DARS2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, human placenta tissue, U-937 cells Positive IHC detected in: mouse cerebellum tissue, human brain tissue, human testis tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DARS2 is also named as AspRS (aspartyl-tRNA synthetase) and belongs to the class-II aminoacyl-tRNA synthetase family. The deduced 645-amino acid protein has a 47-amino acid mitochondrial targeting signal, resulting in a mature protein of 598 amino acids. DARS2 contains conserved residues involved in ATP binding, tRNA binding, and aspartic acid recognition, as well as catalytic site motifs characteristic of amino acid tRNA synthetases. It is a dimeric proteins(PMID:19443655). Rat aspartyl-tRNA synthetase has a N-terminal polypeptide extension of about 40 amino acid residues which can be removed without impairing its catalytic activity(PMID:9030747). This protein has different molecular mass(55 kDa, 50 kDa,66 kDa ) according to the publications(PMID:11306575; 19443655;15299749). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4809 Product name: Recombinant human DARS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 296-645 aa of BC045173 Sequence: LIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH Predict reactive species Full Name: aspartyl-tRNA synthetase 2, mitochondrial Calculated Molecular Weight: 645 aa, 74 kDa Observed Molecular Weight: 66-74 kDa GenBank Accession Number: BC045173 Gene Symbol: DARS2 Gene ID (NCBI): 55157 RRID: AB_2088759 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6PI48 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.