Proteintech, 13821-1-AP, ARTS1 Polyclonal antibody

Size: 20ul / 150ul The ARTS1 (13821-1-AP) by Proteintech is a Polyclonal antibody targeting ARTS1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 13821-1-AP targets ARTS1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, Jurkat cells Positive IP detected in: Jurkat cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information ARTS1 is an endoplasmic reticulum-associated aminopeptidase (also known as ERAP1). ERAP1 is induced by interferon-gama and can degrade peptides 9-15 residues long(PMID:18987748).ARTS1 is a 100 kDa, monomeric, soluble zinc aminopeptidase. It can be glycosylated to 120KDa and form homodimers and heterodimers(PMID:15908954). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4918 Product name: Recombinant human ERAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 642-941 aa of BC030775 Sequence: NAFQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLSLPVDVTLAVFAVGAQSTEGWDFLYSKYQFSLSSTEKSQIEFALCRTQNKEKLQWLLDESFKGDKIKTQEFPQILTLIGRNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKENGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERM Predict reactive species Full Name: endoplasmic reticulum aminopeptidase 1 Calculated Molecular Weight: 107 kDa Observed Molecular Weight: 106 kDa GenBank Accession Number: BC030775 Gene Symbol: ARTS1/ERAP1 Gene ID (NCBI): 51752 RRID: AB_2293531 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZ08 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.