Iright
BRAND / VENDOR: Proteintech

Proteintech, 13849-1-AP, SH3GL3 Polyclonal antibody

CATALOG NUMBER: 13849-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SH3GL3 (13849-1-AP) by Proteintech is a Polyclonal antibody targeting SH3GL3 in WB, ELISA applications with reactivity to human, mouse, rat samples 13849-1-AP targets SH3GL3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, mouse brain tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SH3GL3 is a novel member of SH3-containing family that has a src-homology-3 domain (SH3) at the C-terminus and drives protein-protein interactions through binding to proline-rich ligands. SH3GL3 is selectively expressed in brain and testis, and plays important role in signal transduction and regulation of synaptic vesicles. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4819 Product name: Recombinant human SH3GL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-288 aa of BC042864 Sequence: MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTAYSRLEPAD Predict reactive species Full Name: SH3-domain GRB2-like 3 Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC042864 Gene Symbol: SH3GL3 Gene ID (NCBI): 6457 RRID: AB_2187423 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99963 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924