Iright
BRAND / VENDOR: Proteintech

Proteintech, 13854-1-AP, SORBS1 Polyclonal antibody

CATALOG NUMBER: 13854-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SORBS1 (13854-1-AP) by Proteintech is a Polyclonal antibody targeting SORBS1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 13854-1-AP targets SORBS1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: 3T3-L1 cells, HEK-293 cells, mouse kidney tissue, mouse liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human stomach tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The sorbin homology (SoHo) family of adapter and scaffold proteins consists of three proteins: CAP, also known as Sorbin and SH3 domain containing 1 (Sorbs1), ArgBP2, also known as Sorbs2, and Vinexin, also known as Sorbs3. All Sorbs proteins are highly expressed in heart tissue, skeletal muscle, adipose tissue, and cells of the immune system, functioning as SH3-domain-mediated adaptors of scaffolding molecules(PMID: 32738595). SORBS1 can bind to signaling molecules (e.g., c-Cbl, c-Abl, and insulin reporter) to regulate glucose transport, transcription activity, and insulin signaling(PMID: 27791200). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4828 Product name: Recombinant human SORBS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC042612 Sequence: MSSECDGGSKAVMNGLAPGSNGQDKDMDPTKICTGKGAVTLRASSSYRETPSSSPASPQETRQHESKPDEWRLSSSADANGNAQPSSLAAKGYRSVHPNLPSDKSQDATSSSAAQPEVIVVPLYLVNTDRGQEGTARPPTPLGPLGCVPTIPATASAASPLTFPTLDDFIPPHLQRWPHHSQPARASGSFAPISQTPPSFSPPPPLVPPAPEDLRRVSEPDLTGAVSSTDSSPLLNEVSSSLIGTDSQAFPSVSKPSSAYPSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQDS Predict reactive species Full Name: sorbin and SH3 domain containing 1 Calculated Molecular Weight: 1292 aa, 142 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC042612 Gene Symbol: SORBS1 Gene ID (NCBI): 10580 RRID: AB_11232224 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BX66 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924