Iright
BRAND / VENDOR: Proteintech

Proteintech, 13858-1-AP, EP400 Polyclonal antibody

CATALOG NUMBER: 13858-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EP400 (13858-1-AP) by Proteintech is a Polyclonal antibody targeting EP400 in IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 13858-1-AP targets EP400 in IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: HEK-293 cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, U2OS cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information E1A binding protein p400 (EP400) is a SWR1-class ATP-dependent chromatin remodeling protein originally identified as an interacting partner for the adenovirus E1A protein required for viral replication and cellular transformation. EP400 plays a crucial role in promoting double-strand break (DSB) repair through homologous recombination (PMID: 26669263, 37922899). Depletion of Ep400 in oocytes led to accumulated DSBs, causing abnormal aggregation and dysfunction of cytoplasmic organelles, resulting in impaired oocyte development and declined oocyte quality (PMID: 38493496). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4832 Product name: Recombinant human EP400 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC037208 Sequence: MHHGTGPQNVQHQLQRSRACPGSEGEEQPAHPNPPPSPAAPFAPSASPSAPQSPSYQIQQLMNRSPATGQNVNITLQSVGPVVGGNQQITLAPLPLPSPTSPGFQFSAQPRRFEHGSPSYIQVTSPLSQQVQTQSPTQPSPGPGQALQNVRAGAPGPGLGLCSSSPTGGFVDASVLVRQISLSPSSGGHFVFQDGSGLTQIAQGAQVQLQHPGTPITVRERRPSQPHTQSGGTIHHLGPQSPAAAGGAGLQPLASPSHITTANLPPQISSIIQGQLVQQQQVLQGPPLPRPLGFERTPGV Predict reactive species Full Name: E1A binding protein p400 Calculated Molecular Weight: 3160 aa, 344 kDa Observed Molecular Weight: 344 kDa GenBank Accession Number: BC037208 Gene Symbol: EP400 Gene ID (NCBI): 57634 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96L91 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924