Iright
BRAND / VENDOR: Proteintech

Proteintech, 13898-1-AP, MAP2K3 Polyclonal antibody

CATALOG NUMBER: 13898-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MAP2K3 (13898-1-AP) by Proteintech is a Polyclonal antibody targeting MAP2K3 in WB, ELISA applications with reactivity to human, mouse, rat samples 13898-1-AP targets MAP2K3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, mouse skeletal muscle tissue, A549 cells, THP-1 cells, rat skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information MAP2K3, also named MKK3, is a member of the dual specificity kinase group and serves as a specific activator of p38 MAPK with MKK6. MKK3 can be phosphorylated by cytokines and environmental stress at sites Ser189 and Thr193 by MKKK proteins (MEKK 1-4). MKK3 plays a key role in cell differentiation, motility, division, and death. It has been reported that MKK3 targeting may represent an effective and potentially safe therapeutic strategy to selectively kill cancer cells in colorectal cancer patients. (PMID: 31695024, 30770795, 26805700, 8622669) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4861 Product name: Recombinant human MAP2K3 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-347 aa of BC032478 Sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS Predict reactive species Full Name: mitogen-activated protein kinase kinase 3 Calculated Molecular Weight: 347 aa, 39 kDa Observed Molecular Weight: 36-40 kDa GenBank Accession Number: BC032478 Gene Symbol: MAP2K3 Gene ID (NCBI): 5606 RRID: AB_10642959 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P46734 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924