Iright
BRAND / VENDOR: Proteintech

Proteintech, 13908-1-AP, SLAIN2 Polyclonal antibody

CATALOG NUMBER: 13908-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLAIN2 (13908-1-AP) by Proteintech is a Polyclonal antibody targeting SLAIN2 in WB, ELISA applications with reactivity to human, mouse, rat samples 13908-1-AP targets SLAIN2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, Transfected HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information SLAIN2 (SLAIN Motif Family Member 2), also known as KIAA1458, is a microtubule plus-end tracking protein (+TIP) that forms a complex with end-binding proteins (EBs), cytoplasmic linker proteins (CLIPs), and ch-TOG. SLAIN2 binds to the plus end of microtubules and regulates microtubule growth and organization. SLAIN2 consists of 581 amino acids and has a calculated molecular weight of approximately 63 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4888 Product name: Recombinant human SLAIN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 231-581 aa of BC040993 Sequence: PGNSGNLKSSDRNPPLSPQSSIDSELSASELDEDSIGSNYKLNDVTDVQILARMQEESLRQEYAATTSRRSSGSSCNSTRRGTFSDQELDAQSLDDEDDNMHHAVYPAVNRFSPSPRNSPRPSPKQSPRNSPRSRSPARGIEYSRVSPQPMISRLQQPRLSLQGHPTDLQTSNVKNEEKLRRSLPNLSRTSNTQVDSVKSSRSDSNFQVPNGGIPRMQPQASAIPSPGKFRSPAAPSPLALRQPVKAFSNHGSGSPGSQEITQLTQTTSSPGPPMVQSTVSANPPSNINSATLTRPAGTTAMRSGLPRPSAPSAGGIPVPRSKLAQPVRRSLPAPKTYGSMKDDSWKDGCY Predict reactive species Full Name: SLAIN motif family, member 2 Calculated Molecular Weight: 581 aa, 63 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC040993 Gene Symbol: SLAIN2 Gene ID (NCBI): 57606 RRID: AB_2877987 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P270 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924