Iright
BRAND / VENDOR: Proteintech

Proteintech, 13915-1-AP, SPAG8 Polyclonal antibody

CATALOG NUMBER: 13915-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPAG8 (13915-1-AP) by Proteintech is a Polyclonal antibody targeting SPAG8 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13915-1-AP targets SPAG8 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: DU 145 cells Positive IP detected in: mouse testis tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SPAG8, also named as Sperm-associated antigen 8 or HSD-1, is a 426 amino acid protein, which is expressed in testis (germ cells), but not in liver, kidney, prostate and small intestine. SPAG8 may play a role in fertility and microtubule formation through interaction with RANBP9. SPAG8 as testis-specific protein is produced during male germ cell differentiation and functions in a germ cell type- and stage-specific manner during spermatogenesis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4910 Product name: Recombinant human SPAG8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC019247 Sequence: METNGSTEGSRSRSRSLDIQPSSEGLGPTSEPFPSSDDSPRSALAAATAAAAAAASAAAATAAFTTAKAAALSTKTPAPCSEFMEPSSDPSLLGEPCAGPGFTHNIAHGSLGFEPVYVSCIAQDTCTTTDHSSNPGPVPGSSSGPVLGSSSGAGHGSGSGSGPGCGSVPGSGSGPGPGSGPGSGPGHGSGSHPGPASGPGPDTGPDSELSPCIPPGFRNLVADRVLNYTSWSQHCPWEPQKQPPWEFLQVLEPGARGLWKPPDIKGKLMVCYETLPRGQCLLYNWEEERATNHLDQVPSMQ Predict reactive species Full Name: sperm associated antigen 8 Calculated Molecular Weight: 45 kDa, 54 kDa Observed Molecular Weight: 56-70 kDa GenBank Accession Number: BC019247 Gene Symbol: SPAG8 Gene ID (NCBI): 26206 RRID: AB_2194804 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99932 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924