Proteintech, 14003-1-AP, IGSF11 Polyclonal antibody

Size: 20ul / 150ul The IGSF11 (14003-1-AP) by Proteintech is a Polyclonal antibody targeting IGSF11 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14003-1-AP targets IGSF11 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, mouse skeletal muscle tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5094 Product name: Recombinant human IGSF11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 262-430 aa of BC034411 Sequence: GAFFYWRSKNKEEEEEEIPNEIREDDLPPKCSSAKAFHTEISSSDNNTLTSSNAYNSRYWSNNPKVHRNTESVSHFSDLGQSFSFHSGNANIPSIYANGTHLVPGQHKTLVVTANRGSSPQVMSRSNGSVSRKPRPPHTHSYTISHATLERIGAVPVMVPAQSRAGSLV Predict reactive species Full Name: immunoglobulin superfamily, member 11 Calculated Molecular Weight: 430 aa, 46 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC034411 Gene Symbol: IGSF11 Gene ID (NCBI): 152404 RRID: AB_10603368 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5DX21 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.