Iright
BRAND / VENDOR: Proteintech

Proteintech, 14040-1-AP, ACRV1 Polyclonal antibody

CATALOG NUMBER: 14040-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ACRV1 (14040-1-AP) by Proteintech is a Polyclonal antibody targeting ACRV1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 14040-1-AP targets ACRV1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: DU 145 cells, LNCaP cells, PC-3 cells Positive IP detected in: DU 145 cells Positive IHC detected in: human testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The protein ACRV1, also known as SP-10, is an acrosomal matrix protein, which is evolutionarily conserved among mammals. It is associated with the matrix of the acrosomal vesicle in developing spermatids and the acrosomal matrix and membranes of ejaculated sperm (PMID: 8288254). Human ACRV1 protein has 11 isoforms, and molecular weight ranges from 9 to 28 kDa. ACRV1 was predominantly located in round and elongated spermatids in the testis, indicating that ACRV1 may play an important role in mammalian spermatogenesis and may be a target of a contraceptive vaccine (PMID: 21488928; 8874713). Specification Tested Reactivity: human Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5109 Product name: Recombinant human ACRV1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-265 aa of BC014588 Sequence: MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI Predict reactive species Full Name: acrosomal vesicle protein 1 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 13-36 kDa GenBank Accession Number: BC014588 Gene Symbol: ACRV1 Gene ID (NCBI): 56 RRID: AB_10640426 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P26436 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924