Iright
BRAND / VENDOR: Proteintech

Proteintech, 14055-1-AP, USP16 Polyclonal antibody

CATALOG NUMBER: 14055-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The USP16 (14055-1-AP) by Proteintech is a Polyclonal antibody targeting USP16 in WB, IHC, IP, ELISA applications with reactivity to human samples 14055-1-AP targets USP16 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells Positive IP detected in: HeLa cells Positive IHC detected in: human liver tissue, human brain tissue, human spleen tissue, human ovary tissue, human kidney tissue, human heart tissue, human testis tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information USP16 (Ubiquitin specific peptidase 16) was originally identified as a DUB of histone H2A which is implicated in cell cycle progression and HOXD10 gene expression (PMID:17914355). The knockout study has reported that depletion of USP16 results in early embryonic lethality in mice (PMID:24784029). Moreover, USP16 mediated the deubiquitination and stabilization of Drp1 through its direct interaction with Drp1 (PMID:37488647). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4981 Product name: Recombinant human USP16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-386 aa of BC030777 Sequence: MGKKRTKGKTVPIDDSSETLEPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDYVRKHASITTPKPEKDNGNIELENKKLEKESKNEQEREKKENMAKENPPMNSPCQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPDLALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGVVTPKELFSQVCKKAVRFKGYQQQDSQELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEELKNKVKDYEKKKSMPSFVDRIFGGELTSMIMCDQCRTVSLVHESFLDLSL Predict reactive species Full Name: ubiquitin specific peptidase 16 Calculated Molecular Weight: 94 kDa Observed Molecular Weight: 100-120 kDa GenBank Accession Number: BC030777 Gene Symbol: USP16 Gene ID (NCBI): 10600 RRID: AB_2272832 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5T5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924