Iright
BRAND / VENDOR: Proteintech

Proteintech, 14063-1-AP, SETD8 Polyclonal antibody

CATALOG NUMBER: 14063-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SETD8 (14063-1-AP) by Proteintech is a Polyclonal antibody targeting SETD8 in WB, IHC, ELISA applications with reactivity to human, mouse samples 14063-1-AP targets SETD8 in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, RAW 264.7 cells, HepG2 cells, A549 cells, NIH/3T3 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information SETD8, also known as Set8, PR-Set7, or KMT5A, is a member of the SET domain family of histone lysine methyltransferases and, to date, the only known enzyme that catalyzes monomethylation of H4K20 in eukaryotes, which is involved in DNA damage response, mitotic condensation, and DNA replication. SETD8 is overexpressed in various types of tumors, such as bladder cancer, non-small cell lung carcinoma, and small cell lung carcinoma, and is associated with a shorter survival time for gastric, esophageal, and prostate cancer patients. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5114 Product name: Recombinant human SETD8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-352 aa of BC050346 Sequence: MARGRKMSKPRAVEAAAAAAAVAATAPGPEMVERRGPGRPRTDGENVFTGQSKIYSYMSPNKCSGMRFPLQEENSVTHHEVKCQGKPLAGIYRKREEKRNAGNAVRSAMKSEEQKIKDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVRHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH Predict reactive species Full Name: SET domain containing (lysine methyltransferase) 8 Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC050346 Gene Symbol: SETD8 Gene ID (NCBI): 387893 RRID: AB_2878006 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQR1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924