Iright
BRAND / VENDOR: Proteintech

Proteintech, 14081-1-AP, TSSK6 Polyclonal antibody

CATALOG NUMBER: 14081-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TSSK6 (14081-1-AP) by Proteintech is a Polyclonal antibody targeting TSSK6 in WB, ELISA applications with reactivity to human, mouse, rat samples 14081-1-AP targets TSSK6 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information TSSK6 (testis-specific serine kinase 6) is a testis-specific protein kinase that is highly conserved in mammals and essential for spermatogenesis. In spermatozoa, TSSK6 is expressed after meiosis and is localized to the nucleus of spermatocytes and to the posterior part of the head of spermatocytes. TSSK6-deficient spermatozoa exhibit a defective histone-to-fischerin transition (required for chromatin remodeling after meiosis), as well as a reduction in actin polymerization in spermatocytes. The result is striking morphological defects in the spermatozoa, including nuclear malformations, a hairpin shape with the head facing backward, or complete separation of the head. In addition, Tssk6 is frequently aberrantly expressed in colorectal cancer and exhibits oncogenic activity. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5209 Product name: Recombinant human TSSK6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-273 aa of BC014611 Sequence: MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG Predict reactive species Full Name: testis-specific serine kinase 6 Calculated Molecular Weight: 30.3 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC014611 Gene Symbol: TSSK6 Gene ID (NCBI): 83983 RRID: AB_3669176 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXA6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924