Iright
BRAND / VENDOR: Proteintech

Proteintech, 14093-1-AP, SNAP91 Polyclonal antibody

CATALOG NUMBER: 14093-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SNAP91 (14093-1-AP) by Proteintech is a Polyclonal antibody targeting SNAP91 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 14093-1-AP targets SNAP91 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information SNAP91, also known as AP180 or CALM, is a clathrin-coat assembly protein that sequesters clathrin. SNAP91/AP180 is required for clathrin-dependent endocytosis and SV reformation (PMID: 26903854; PMID: 31843760).The AP180 N-terminal homology (ANTH) domains is crucially involved in membrane budding processes, along with and Epsin N-terminal homology (ENTH) domains (PMID: 29774507). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5224 Product name: Recombinant human SNAP91 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 251-600 aa of BC060818 Sequence: LKVAEAPSSLMETLEQHLNTLEGKKPGNKSGAPSPLSKSSPATTVTSPNSTPAKTIDTSPPVDLFATASAAVPVSTSKPSSDLLDLQPDFSSGGAAAAAAPAPPPPAGGATAWGGFGGSFMAPSPSPVTPAQNNLLQPNFEAAFGTTPSTSSSSSFDPSVFDGLGDLLMPTMAPAGQPAPVSMVPPSPAMAASKALGSDLDSSLASLVGNLGISGTTTKKGDLQWNAGEKKLTGGANWQPKVAPATWSAGVPPSAPLQGAVPPTSSVPPVAGAPSVGQPGAGFGMPPAGTGMPMMPQQPVMFAQPMMRPPFGAAAVPGTQLSPSPTPASQSPKKPPAKDPLADLNIKDFL Predict reactive species Full Name: synaptosomal-associated protein, 91kDa homolog (mouse) Calculated Molecular Weight: 92.5 kDa Observed Molecular Weight: 160 kDa GenBank Accession Number: BC060818 Gene Symbol: SNAP91 Gene ID (NCBI): 9892 RRID: AB_2923560 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60641 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924