Iright
BRAND / VENDOR: Proteintech

Proteintech, 14101-1-AP, PRR13 Polyclonal antibody

CATALOG NUMBER: 14101-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PRR13 (14101-1-AP) by Proteintech is a Polyclonal antibody targeting PRR13 in WB, ELISA applications with reactivity to human samples 14101-1-AP targets PRR13 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information PRR13, also named as TXR1, is reported to be a key regulator of the resistance to cytostatica by decreasing the copy number of the proapoptotic gene thrombospondin-1. PRR13 has some isoforms with MW 10 kDa, 15-17 kDa and 19-23 kDa. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5280 Product name: Recombinant human PRR13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-148 aa of BC066943 Sequence: MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHGNPAFPPGGPPHPVPQPGYPGCQLLGPYPPPYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKKMKKAHKKMHKHQKHHKYHKHGKHSSSSSSSSSSDSD Predict reactive species Full Name: proline rich 13 Calculated Molecular Weight: 15.2 kDa Observed Molecular Weight: ~20 kDa GenBank Accession Number: BC066943 Gene Symbol: PRR13 Gene ID (NCBI): 54458 RRID: AB_2878012 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZ81 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924