Proteintech, 14119-1-AP, MARCH8 Polyclonal antibody

Size: 20ul / 150ul The MARCH8 (14119-1-AP) by Proteintech is a Polyclonal antibody targeting MARCH8 in WB, IP, ELISA applications with reactivity to human, mouse samples 14119-1-AP targets MARCH8 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IP detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information MARCH8 (Membrane-associated RING finger protein 8) is also named as MIR, RNF178 and belongs to the RING zinc finger protein family. It functions as an E3 ubiquitin ligase for immune recognition-related molecules (e.g. major histocompatibility complex class I, B7-2, and ICAM-1). It plays a key role in controlling MHC class II surface expression by regulated ubiquitination of a lysine residue in the beta-chain (PMID:22761441). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5268 Product name: Recombinant human MARCH8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-158 aa of BC066988 Sequence: MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASAPAPVSSFSRTSITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLRKWEKLQMTSSERRKIMCS Predict reactive species Full Name: membrane-associated ring finger (C3HC4) 8 Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 30-33 kDa GenBank Accession Number: BC066988 Gene Symbol: MARCH8 Gene ID (NCBI): 220972 RRID: AB_2140168 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5T0T0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.